SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0JBX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0JBX8
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.97e-20
Family N-terminal domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 123-204
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.36e-18
Family Middle domain of MutM-like DNA repair proteins 0.0061
Further Details:      
 
Domain Number 3 Region: 215-260
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000884
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0JBX8
Sequence length 288
Comment (tr|A0A0A0JBX8|A0A0A0JBX8_9MICO) DNA glycosylase {ECO:0000313|EMBL:KGN34678.1} KW=Complete proteome; Reference proteome OX=1385520 OS=Knoellia sinensis KCTC 19936. GN=N802_00895 OC=Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Knoellia.
Sequence
MPEGDTIWRTAHRLHQALVGAEIAVSDFRFPDLATLDVCGSVTTEVVSVGKHLLHRLDSG
ITIHSHLKMEGQWRIERPGDAAPWMRRGDLRAAVGTEQWVALGLRLGALAALPTSRELEV
VGHLGPDVLGPGWDPHVACQRIASAGTVIGAALLDQRLLAGVGTIWASESLFIERLGPWS
SAQDLGQEELAALVDRIHHLMDRARRGGVQSSTGSRRRGEELLVHGRSGRPCRRCGTTIR
VAPTGPAGRQRTLFYCPTCQGGLAPDDAGEPQRPLGSARGRGSTERRR
Download sequence
Identical sequences A0A0A0JBX8
WP_035910885.1.97350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]