SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MA39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MA39
Domain Number 1 Region: 212-339
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 1.83e-43
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0000844
Further Details:      
 
Domain Number 2 Region: 13-196
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.09e-31
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MA39
Sequence length 342
Comment (tr|A0A0A0MA39|A0A0A0MA39_9GAMM) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome; Reference proteome OX=1385515 OS=Lysobacter defluvii IMMIB APB-9 = DSM 18482. GN=N791_05340 OC=Xanthomonadaceae; Lysobacter.
Sequence
MSLPFRILRDVPLQGRNSFGVAATAGLLAEVDDPESLPGLLARPEFGRAMVLGGGSNLLL
AGDPQQPLVALTGQRVEVLGEQGPATRVRVEAGTHWHRFVLHTLELGLCGLENLALIPGT
VGAAPIQNIGAYGVEVGEFVHAVRAYEPATGRWHDFSRADCAFAYRDSLFKQHPDRFVVT
AVEFALPREAAPRLSYAGLAEELARAGIDRPTARDVADAVIAIRRRKLPDPAVLGNAGSF
FKNPLVPAARAGALVESNPGLPCYGDGPLRKLSAAWLIEACGWKGHRDGDAGVSPGHALV
LVNHGQATGAQLLALARRIAGSVQERFGVALEPEPRVVGDQW
Download sequence
Identical sequences A0A0A0MA39
WP_027068995.1.100449 WP_027068995.1.73016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]