SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0QEZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0QEZ8
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 3.66e-78
Family Bacterial photosystem II reaction centre, L and M subunits 0.000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0QEZ8
Sequence length 195
Comment (tr|A0A0A0QEZ8|A0A0A0QEZ8_9MARC) PsbA {ECO:0000313|EMBL:AII83359.1} OX=1387322 OS=Oryzolejeunea saccatiloba. GN=psbA OC=Lejeuneaceae; Oryzolejeunea.
Sequence
MTATLERRESASIWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMH
Download sequence
Identical sequences A0A0A0QEZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]