SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0URT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0URT4
Domain Number 1 Region: 36-203,267-286
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.06e-94
Family Cytochrome f, large domain 0.0000000172
Further Details:      
 
Domain Number 2 Region: 203-266
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.17e-18
Family Cytochrome f, small domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 283-321
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000144
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0URT4
Sequence length 321
Comment (tr|A0A0A0URT4|A0A0A0URT4_9ASPA) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=512271 OS=Corallorhiza maculata var. mexicana. GN=petA OC=Epidendroideae; Epidendreae; Calypsoinae; Corallorhiza.
Sequence
MQNRNTFSWVKEQMTRSIYVSIMIYVITRASISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEMKEKMGNLSFQCYRPNKRNILVIGPVPGHKYSEIVFPILSPEPVTKKDVYFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVSRIARKEKKGGYEITIVDASEGRQVV
DIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDTEIVLQDPLRVQGLLFFLASVILA
QIFLVLKKKQFEKVQLYEMNF
Download sequence
Identical sequences A0A0A0URT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]