SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0UX85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0UX85
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.22e-22
Family F1F0 ATP synthase subunit C 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0UX85
Sequence length 81
Comment (tr|A0A0A0UX85|A0A0A0UX85_9ASPA) ATP synthase CF0 subunit III {ECO:0000313|EMBL:AIW51590.1} OX=451881 OS=Corallorhiza trifida. GN=atpE OC=Epidendroideae; Epidendreae; Calypsoinae; Corallorhiza.
Sequence
MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM
EALTIYGLVVALAILFANPFV
Download sequence
Identical sequences A0A0A0UQD8 A0A0A0URL5 A0A0A0USU6 A0A0A0UUC9 A0A0A0UUJ7 A0A0A0UWE5 A0A0A0UX85 A0A291F3H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]