SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0V3Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0V3Q8
Domain Number 1 Region: 13-23
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000654
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0V3Q8
Sequence length 232
Comment (tr|A0A0A0V3Q8|A0A0A0V3Q8_9POAL) LEAFY {ECO:0000313|EMBL:AIW61278.1} OX=863016 OS=Indosasa triangulata. GN=LEAFY OC=Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Indosasa.
Sequence
AHPFRWDLGPPAPPPPPPPPPPPAPPANAPRELEDLVAGYGVRLSTVARILELGFTASTL
LAMTERELDDMMAALAGLFRWDLLLGERFGLRAALRAERGRLMSLGGRHHGHQSGSTVDA
ASQDVLSDEQDAAASGGMGDDDTGRRMVSGKKQAKKAASTRKGKKARRKKVDELRLDMQD
DEREGDEDGGGGSESSESSAGGGVGERQREHPFVVTEPGEVARAKKNGLDYL
Download sequence
Identical sequences A0A0A0V3Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]