SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0WXW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0WXW4
Domain Number - Region: 29-115
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00133
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0WXW4
Sequence length 138
Comment (tr|A0A0A0WXW4|A0A0A0WXW4_BACMY) Uncharacterized protein {ECO:0000313|EMBL:AIW87990.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=bwei_5458 OC=Bacillus cereus group.
Sequence
MSIYYELTLLSENKQEGIYELAKMATNATNNDTVELIQLKEWEKDFLICQYPDGETAWFG
TLPHGYDLNGLTSKEYIIEQLLNEFEQELEEVYWVNLDTEDYYACCYEEYIFKTNRSIYF
LVCKSMIKNIKIRLLHRF
Download sequence
Identical sequences A0A0A0WXW4 C2STW7 R8HDN4
WP_002035148.1.17940 WP_002035148.1.30061 WP_002035148.1.4496 WP_002035148.1.57105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]