SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1CX65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1CX65
Domain Number 1 Region: 6-89
Classification Level Classification E-value
Superfamily YajQ-like 6.93e-27
Family YajQ-like 0.001
Further Details:      
 
Domain Number 2 Region: 91-162
Classification Level Classification E-value
Superfamily YajQ-like 4.19e-22
Family YajQ-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1CX65
Sequence length 162
Comment (tr|A0A0A1CX65|A0A0A1CX65_9MICC) UPF0234 protein ART_2233 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome; Reference proteome OX=1494608 OS=Arthrobacter sp. PAMC 25486. GN=ART_2233 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MASESTFDVVSKVDKQEVANALHQTQKEVAQRYDFKGIGAEIDFSGEKILLKANSEERVL
AVMDVFESKLIKRGISLKSLDAGEPYASGKEYRQEAEIKEGIAQDVAKKINKLIRDEGPK
GVKSTIQGDELRVSSKSRDDLQEVMNMLRKFEDTDLQFVNLR
Download sequence
Identical sequences A0A0A1CX65
WP_038464857.1.71160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]