SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1EMQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1EMQ0
Domain Number 1 Region: 46-197
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 8.24e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00018
Further Details:      
 
Domain Number 2 Region: 202-282
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.75e-31
Family BC N-terminal domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00000000000000406
Family BC ATP-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1EMQ0
Sequence length 283
Comment (tr|A0A0A1EMQ0|A0A0A1EMQ0_9NEOP) Carbamoylphosphate synthase domain protein {ECO:0000313|EMBL:AIY30866.1} OX=1546301 OS=Narope cyllabarus. GN=CAD OC=Papilionoidea; Nymphalidae; Satyrinae; Brassolini; Narope.
Sequence
SLDYCVVKIPRWDLAKFNRVSTKIGSSMKSVGEVMAIGRSFEEAFQKALRMVDENVNGFD
PYIKKVNENELKEPTDKRMFVXAAALKNNYTIDKLYELTKIDRWFLEKLKNITDYYTKLE
SITSGSISFDILKQAKQIGFSDKQIAAAIKSTELVVRKWREEYLITPYVKQIDTVAAEWP
ASTNYLYLTYNGSSHDIDFPGEFIMVLGSGVYRIGSSVEFDWCAVGCLRELKNQNKQTIM
VNYNPETVSTDYDMSNRLYFEEISFEVVMDIYRLEKPDGVILC
Download sequence
Identical sequences A0A0A1EMQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]