SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1FMC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1FMC5
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.15e-19
Family F1F0 ATP synthase subunit C 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1FMC5
Sequence length 81
Comment (tr|A0A0A1FMC5|A0A0A1FMC5_9BURK) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome; Reference proteome OX=279058 OS=Collimonas arenae. GN=LT85_4954 OC=Oxalobacteraceae; Collimonas.
Sequence
MTDLSFVALACGLIIGLGAIGACIGIAIMGGKYLEASARQPELMNTLQTKMFLLAGLIDA
AFLIGVGIAMLFAFANPFVPK
Download sequence
Identical sequences A0A0A1FMC5 A0A2D2DEM5 A0A2G8T1K4
WP_038494309.1.67730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]