SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A1H7E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1H7E6
Domain Number 1 Region: 806-1186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.88e-118
Family PFOR PP module 0.0000000328
Further Details:      
 
Domain Number 2 Region: 10-263
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-74
Family PFOR Pyr module 0.0000000361
Further Details:      
 
Domain Number 3 Region: 427-680
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-71
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000945
Further Details:      
 
Domain Number 4 Region: 265-424
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.85e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000119
Further Details:      
 
Domain Number 5 Region: 684-770
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.57e-18
Family Ferredoxin domains from multidomain proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1H7E6
Sequence length 1201
Comment (tr|A0A0A1H7E6|A0A0A1H7E6_9BURK) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome; Reference proteome OX=1469502 OS=Burkholderiales bacterium GJ-E10. GN=E1O_20430 OC=Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales.
Sequence
MADGNSMPTTATMTGNAAVAHVAYRVNEVCAIYPITPSSPMAELADEWTAQKLTNIWGGI
PVVQEMQSEGGAAGAVHGALQSGALTTTFTASQGLLLMIPNMFKIAGELTPTVFHVAARA
VATQALSIFGDHSDVMAVRSTGFALLSSGSVQEAHDTALIAQAATLESRVPFLHFFDGFR
TSHEYNKIVVLSDAQIRAMIRQDLVRAHRDRALNPEHPFIRGTAHNPDTFFQARETVNPY
YARVPAIVQAAMDRFADLTGRAYRLFEYDGPADAERVVVLMGSGAETARETAAFLRGRGE
RVGVLQIRLYRPFAADAFLAALPESCRALAVLEQTKEPGATGEPLYLDVVTTLAQAVAAG
TRKTMPRIVGGRYGLGSKNFNPAQAKAVFDELCRPAPRNSFTVGIDDDVSHTSLPIDPNF
SIEADDVTRALFFGLGADGTVGANENSVRIIAESPDMYAQGYFVYDSHKSGAQTVSHLRF
GKRPIHSPYLVESAGFIACHQAEFLDRIDVLERAAEGGVFLLNTPHGPDVVWDRLPRSVQ
QRILDRKLRFHVIDASKVAREAGLGGRINTVLQTCFFAISGVLPRDEAIRRIKASIERSY
GAKGADVVRRNHQAVDRALAHLFAVRVPDAVTSPFERPAIVPDSAPAFVREVTARMMRGL
GSGDDIRVSQLPADGTWPSGTAAFEKRNVSDIVARWDPALCIQCGQCGFVCPHGVIRTRY
FNEHRLAGAPPGFPSAPVNSRGNPEVRFSLAVYVEDCTGCGLCYEACPARSPADAAVRAI
NLGDKAPILESARADIAFFETLPVNDRACVDFANVRGVQFLQPLFEFPGACAGCGETPYL
RLLSQLFGDRLQIANATGCSSIYGGNLPVTPWTKDAAGRGPAWSNSLFEDNAEFGLGFRL
AADKHVELARRLLRRLAPKLGEESVRAILDAPQERESELRAQRSRVEALKRQLATVDDEA
ARDLLSVVDHLVRRSIWLVGGDGWAYDIGYGGLDHVLATGSNVNVLVLDTEVYSNTGGQS
SKATPLGAVARFAAAGKRVARKDLGLQAIAYGNVYVAQVAMGANPQHTLLAFREAEAYPG
PSLILAYSHCIAHGYDLRQGLRQQDLAAASGNWPLFRFNPAMRKVGERPFRLDSPRPTIA
LRDYAYNELRYSALAKSDPDTAAMLLAQAQQVVTEKYRQYEELANRGGESFHPAGIPNPP
V
Download sequence
Identical sequences A0A0A1H7E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]