SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A1NAX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1NAX9
Domain Number 1 Region: 16-188
Classification Level Classification E-value
Superfamily MIR domain 3.05e-30
Family MIR domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1NAX9
Sequence length 196
Comment (tr|A0A0A1NAX9|A0A0A1NAX9_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEI88943.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_03319 OC=Rhizopodaceae; Rhizopus.
Sequence
MSDDQYYGAPLEGNIIKYGNLIALKHNMTGRYLTSRSGDNYEGGSGQQKAFAGGWEASSE
TFFIVLPRFGDERTGEDVNFGDVIRLKHSETRANLHSHPDIASPVTEQQEVTCYGDDSLT
DENDEWIVEQWGFDEAENEEFDVEDPTWYVGRSFILRHVATGVTLHSHDELIAEDANEVT
GYGAGPDENDRWRAVF
Download sequence
Identical sequences A0A0A1NAX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]