SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1NPM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1NPM8
Domain Number 1 Region: 10-80
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000116
Family Ricin B-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1NPM8
Sequence length 81
Comment (tr|A0A0A1NPM8|A0A0A1NPM8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEI98781.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_12881 OC=Rhizopodaceae; Rhizopus.
Sequence
MYSKRYLCEGLFFIKSKHNGSILEALSGCISDGIPIIVDEEDFQKGFNQFWSYDNGYFVN
AKRSKVIAVYDGPIKPKADIV
Download sequence
Identical sequences A0A0A1NPM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]