SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1P4B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1P4B8
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.83e-26
Family Steroid-binding domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1P4B8
Sequence length 110
Comment (tr|A0A0A1P4B8|A0A0A1P4B8_9FUNG) Putative Progesterone binding protein {ECO:0000313|EMBL:CEI98874.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_00856 OC=Rhizopodaceae; Rhizopus.
Sequence
MATEPPKTTPITVSELRKYDGSDPSLPIYVAIKGDVFDVSNNTASYGKGAGYNVFTGKDS
SKALGKSSLKPEDCIADYSELTPKEMETLDQWYAFFAKRYNIVGKVVPDN
Download sequence
Identical sequences A0A0A1P4B8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]