SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1PC12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1PC12
Domain Number 1 Region: 46-76
Classification Level Classification E-value
Superfamily WWE domain 0.000017
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1PC12
Sequence length 102
Comment (tr|A0A0A1PC12|A0A0A1PC12_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEJ01614.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_15637 OC=Rhizopodaceae; Rhizopus.
Sequence
MYQYPPNYNNNNNRLPLTPNSISPTREAKDIMMEGSTSSSESLNDYPQEITWLFFRDNQW
VPFQSNNHYKIEQAFTLGVLVEIGIYVDIKGIHITLTLEIKS
Download sequence
Identical sequences A0A0A1PC12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]