SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1Q0Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1Q0Z4
Domain Number 1 Region: 78-146
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.83e-28
Family Cyanase C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000416
Family Cyanase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1Q0Z4
Sequence length 160
Comment (tr|A0A0A1Q0Z4|A0A0A1Q0Z4_9BACT) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} OX=1522316 OS=bacterium YEK0313. GN=BN1110_04858 OC=Bacteria.
Sequence
MTREQLTEKILDIKREKGWTWAHITEAIGGVSPVLVVGALLGQMKLVKPLAAKAAALFGL
TEMEARMLNEVPYRGTTMPPTDPLIYRFYEMVMVNGPAWKALIEEEFGDGIMSAIDFDIE
IAREPNPRGDRVRISMSGKFLPYRYYGNEQGIAEYGFKEA
Download sequence
Identical sequences A0A0A1Q0Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]