SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1RPS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A1RPS6
Domain Number - Region: 22-40
Classification Level Classification E-value
Superfamily XseB-like 0.0275
Family XseB-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1RPS6
Sequence length 49
Comment (tr|A0A0A1RPS6|A0A0A1RPS6_9ENTR) Uncharacterized protein YhaL {ECO:0000313|EMBL:CEJ63750.1} KW=Complete proteome OX=1563222 OS=Citrobacter pasteurii. GN= OC=Enterobacteriaceae; Citrobacter.
Sequence
MSKKLSKKRQPQAVPEKRETVPFGYEEMLTELEAIVADAELRLEDEEAA
Download sequence
Identical sequences A0A0A1RPS6 I6GPH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]