SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1TSJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1TSJ7
Domain Number 1 Region: 8-249
Classification Level Classification E-value
Superfamily Subtilisin-like 1.7e-40
Family Serine-carboxyl proteinase, SCP 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1TSJ7
Sequence length 251
Comment (tr|A0A0A1TSJ7|A0A0A1TSJ7_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:CEJ94487.1} KW=Complete proteome; Reference proteome OX=1531966 OS=Torrubiella hemipterigena. GN=VHEMI10013 OC=Torrubiella.
Sequence
MCGTFKPTNAISVSYGLAEKLYSASYLKRQCDEFMKLGLQGTTVVVASGDAGVAGRHGDG
CINGGSDRHHHNTVFNPAMPASCPYVTSVGSTIIPPARLKSAVEHFFAKHDPGYASFNIS
DNVIPVPTEGVYNRIGRGFPDVAALGDNAVIVFKGGVRQIGGKSMSAPIFASIMNLINEE
RIKKGKRSIGFANPALYKNTSMFNDVVVGDQLGTEGSCHRKGFSTAESWDPVTGLGTPRY
PDMLAYFLSLP
Download sequence
Identical sequences A0A0A1TSJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]