SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A1U3I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A1U3I3
Domain Number - Region: 28-108
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0149
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1U3I3
Sequence length 243
Comment (tr|A0A0A1U3I3|A0A0A1U3I3_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP88701.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_194500 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MENFSDFISLSVQTKEAMKRLENEYKVFSGITESSHIIPIKKETQNNNIYFKEMEKHYDI
EDEVFLKTQMFFDSTNELRKSLNSILDFVEKLQIEATNRLKKSVSNMNGIVNKMIGIKEE
IFLEQTQDLPEQRMASVKAAFNKEKDELEKIRKTNPAAFSTRKSSQIDSNYQFPTQQKNT
NRYWQGQAKDTSSQPKQLPQKHSQQRTSDAQSDQKQQRSYKPKQDKRTQYSGGQKGQQNF
ALF
Download sequence
Identical sequences A0A0A1U3I3
jCVI|EIN_116770 XP_004255472.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]