SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A1WD25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1WD25
Domain Number 1 Region: 518-709
Classification Level Classification E-value
Superfamily MIR domain 7.32e-54
Family MIR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1WD25
Sequence length 972
Comment (tr|A0A0A1WD25|A0A0A1WD25_ZEUCU) Protein O-mannosyltransferase 1 {ECO:0000313|EMBL:JAC96868.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.5907 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MAMSSNTTTVKRRKTLIKSKSKYADTSRSAVTTTATTTNLTDPVVNSRTTDLFDKATEAN
ASSNKRLQRFSLSDILVGIMPRTTKKEASSNSVSSNTSNNNPTTALVLRATSPTLYNGSI
ACCRDVNCRLNALTALIQQKHHHQCTQRASVCSNSSSSSYMSHTKSSRRSRSSTVTGLNP
TERTVTPAEPANSAAALRDGSPDSGVGSDAAMAKVFHATTETTSDDSTLSSLGRYLTVHL
QLDLCTWFLFVLAVCTRFYKLSIPRHVVFDEIHYGKYISLYLRNIFFFDQHPPLGKQLIA
AVAYTAGGYDGNYTFPHIGAEYNKNVPIFWLRFLPALCGSALAPIVYKLLMSARLSRWSA
LLGGVLIILDNALLTQSRFILMESMLLFFEACGLYYMLRFQDCRFGSSLWLLFGLASASC
FSFATSVKYAGVLTYILTAYLSCRYLWDKLYDATLSNLHIILETIGRIVLFTIVPILLYV
SIFYIHLQTLYRAGPHDSIMTSAFQASLDGGLASITKGQPLKVVHGSQITLRHTHGRTCW
LHSHAHVYPVRYPDKRGSSHQQQVTCYSFKDVNNWWIIKRPNREDLVVGNELDVIRHGDI
IQLVHGITSRGLNSHDVAAPMTPQCQEVSCYIDYEIKMPGELLWRVEILNRDTEGPVWHA
IKSEVRLIHHTTGAALRYSGRQLPEWGFNQHEVVADRTVEHKDAIWNVEEHRYTKTQDQR
ERERQLLKAEMIPTKKTKLSFLAKFFELQTKMLWNTKQLDAHMYSSSPLEWPLLDKGIAY
WVDTKTSSQIHLLGNIIIWYTGTAALIFYIILNVFYVLRRRRLCFDLPEREWHRFRQIGD
IFLVAYFIHYLPYFTLDRALFLHNYLPAFLFKLLLLCYVLEHIDYLLRLHCYGNCKFAVN
GTLQPQRIWLVRSYRLGILLWLTSVIWVFIKFLPLTYGIHKLSVHEVISLRWKDTWDFII
QVNKSINNPINK
Download sequence
Identical sequences A0A0A1WD25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]