SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2CL42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2CL42
Domain Number 1 Region: 12-350
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 1.44e-123
Family Bacterial photosystem II reaction centre, L and M subunits 0.0000000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A2CL42
Sequence length 351
Comment (tr|A0A0A2CL42|A0A0A2CL42_9PROC) Photosystem Q(A) protein {ECO:0000256|HAMAP-Rule:MF_01383} KW=Complete proteome OX=1499502 OS=Prochlorococcus sp. MIT 0701. GN=EV12_2039 OC=Prochlorococcus.
Sequence
MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGLLLLPTAYLALGGWFTGTTFVTSWYTH
GIASSYLEGCNFLSAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWTFVALHGSFA
LIGFMLRQFEIARLVGIRPYNALAFSGPVVVFLACFLIYPLGQHSWFFAPSFGVAAIFRF
ILFLQGFHNWTLNPFHMMGVAGILGGALLCGIHGATVQNTLFEDGAMSNTFKGFDPTQEE
ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGMWTPSVGIVGLAVNLRAYDFVSQ
EVRAAEDPEFETFYTKNVLLNEGIRAWMSVADQPHENFVFPEEVMPRGNAL
Download sequence
Identical sequences A0A0A2CL42
WP_036914375.1.28052 WP_036914375.1.66244 WP_036914375.1.97075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]