SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2ECV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2ECV8
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 3.66e-34
Family N-acetylmuramoyl-L-alanine amidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2ECV8
Sequence length 151
Comment (tr|A0A0A2ECV8|A0A0A2ECV8_9PORP) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:KGN75432.1} KW=Complete proteome; Reference proteome OX=28115 OS=Porphyromonas macacae. GN=HQ47_01740 OC=Porphyromonadaceae; Porphyromonas.
Sequence
MKSESIKYIVLHCSATPCNKRYDKEQMLRDHKNRGFYTWDYHYYVRRDGTLENLRPPTEA
GAHVRGYNTCSIGICYEGGLLPGGQPADTRTREQRRTLRRLVAGLRLRYPKAMITGHRDL
SPDRNGNGIIEETEWLKLCPCFDAAAEYEWL
Download sequence
Identical sequences A0A0A2ECV8
WP_036872884.1.56035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]