SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2R3R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2R3R4
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily TrpR-like 6.28e-29
Family Trp repressor, TrpR 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2R3R4
Sequence length 101
Comment (tr|A0A0A2R3R4|A0A0A2R3R4_MORMO) Trp operon repressor {ECO:0000256|HAMAP-Rule:MF_00475} KW=Complete proteome OX=582 OS=Morganella morganii (Proteus morganii). GN=CRX48_16365 OC=Morganellaceae; Morganella.
Sequence
MTTDQLQDSDWQRFVSLLRNAYSQDIESHLFQLLFTPDERTALGTRVRIVEELLRGKMSQ
RELKSELGVGIATITRGSNSLKYAPEEVKAWLEQELLSGKK
Download sequence
Identical sequences A0A0A2R3R4 A0A1K3HGE1 J7U5Y2 M7C9K7
gi|455737981|ref|YP_007504247.1| WP_004237105.1.10854 WP_004237105.1.11554 WP_004237105.1.17787 WP_004237105.1.24579 WP_004237105.1.24683 WP_004237105.1.28595 WP_004237105.1.36543 WP_004237105.1.37960 WP_004237105.1.4470 WP_004237105.1.45323 WP_004237105.1.51021 WP_004237105.1.51122 WP_004237105.1.52023 WP_004237105.1.63823 WP_004237105.1.65857 WP_004237105.1.6681 WP_004237105.1.6910 WP_004237105.1.73677 WP_004237105.1.78504 WP_004237105.1.80621 WP_004237105.1.81702 WP_004237105.1.87762 WP_004237105.1.90790 WP_004237105.1.93465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]