SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2SKY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2SKY7
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily DsrEFH-like 5.38e-23
Family DsrEF-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2SKY7
Sequence length 131
Comment (tr|A0A0A2SKY7|A0A0A2SKY7_9BACI) Sulfur reduction protein DsrE {ECO:0000313|EMBL:KGP61372.1} KW=Complete proteome OX=198467 OS=Anoxybacillus gonensis. GN=NP92_02990 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
Sequence
MNKRVAIIAANGGLFDAYKVFNIATAAAATEAEVAIFFTFEGLNLIHKEAYKQLPLPEGK
EQIQQGFAQANVPSIPELVSMAQEMGVKFIACQMTMDVMGLTKEHFVDGIDVGGAVTFLD
FAKDADITLTF
Download sequence
Identical sequences A0A094LCA9 A0A0A2SKY7 A0A0B0HGQ7 A0A0D0HP75 A0A0D0Q9B6 M5QSX3
WP_009362055.1.15443 WP_009362055.1.19270 WP_009362055.1.1944 WP_009362055.1.31030 WP_009362055.1.5075 WP_009362055.1.60958 WP_009362055.1.72693 WP_009362055.1.83661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]