SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2T8B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2T8B2
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000000000000942
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2T8B2
Sequence length 122
Comment (tr|A0A0A2T8B2|A0A0A2T8B2_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KGP72042.1} KW=Complete proteome; Reference proteome OX=1385514 OS=Pontibacillus yanchengensis Y32. GN=N782_14270 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MLTNEQIQDLKNRLYEMKTEAEKELDNHKGYESSEGGPEDSVGELSELDNHPGEVGTENF
EQSKDYTLNIHAREQLEEINAALDRIENGKYGYSEKSGKPIPYERLQAMPTARYLVEEQE
NA
Download sequence
Identical sequences A0A0A2T8B2
WP_036821083.1.75669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]