SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2TH75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2TH75
Domain Number 1 Region: 147-351
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.04e-55
Family Class I glutamine amidotransferases (GAT) 0.00000828
Further Details:      
 
Domain Number 2 Region: 4-141
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 1.23e-50
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2TH75
Sequence length 357
Comment (tr|A0A0A2TH75|A0A0A2TH75_9BACI) Carbamoyl-phosphate synthetase glutamine chain {ECO:0000256|HAMAP-Rule:MF_01209} KW=Complete proteome; Reference proteome OX=1385514 OS=Pontibacillus yanchengensis Y32. GN=N782_01305 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MENQGYLLLENGDVFEGTLIGDASSCEGEVVFNTSMTGYQEITTDPSYAGQIIVFCYPLI
GNYGVNDVDDESTSLFISGVVIGENCDAPSHFQSNNTFSTYLATKGVTGISGIDTRTLVK
TIRDTGTKKGKIVKHIPEYLEWEAKSDEVLVSNVSVKEPFTYSNEGPHIVLMDFGYKQSI
VTYLQKQSCKVTIMPYNSSFEEVQQLNPDGVVISNGPGDPQSLQTYLPEMKKLSQAYPIF
GICLGHQLLALAYGGSTSKLKFGHRGSNHPVKHMETGKVYITSQNHGYEVQAESMEGTPF
ITTYKNVNDGSLEGMKHHTLPIYSVQFHPEAHAGPNDTAFMFQQFVELVGEQSYATT
Download sequence
Identical sequences A0A0A2TH75
WP_036816788.1.75669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]