SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2UUY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2UUY7
Domain Number 1 Region: 132-246
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 9.42e-24
Family Kanamycin nucleotidyltransferase (KNTase), C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 9-122
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000409
Family Kanamycin nucleotidyltransferase (KNTase), N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2UUY7
Sequence length 255
Comment (tr|A0A0A2UUY7|A0A0A2UUY7_9BACI) KNTase domain-containing protein {ECO:0000313|EMBL:KGP90578.1} KW=Complete proteome; Reference proteome OX=1385513 OS=Pontibacillus chungwhensis BH030062. GN=N780_04070 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MNLVNDPAQTTPEEKQTMIQTIVNKHVTKHRNDIVAIGVYGSVANGNAGPYSDIEMHIVT
KDGVLLESHEFIYPPYKIEIGSIERSKIIEKAKRYECTWPIWAGSFINVLRVYDPEGFFE
TLKIYPYSHNEEEKRGVMREFMIWEPYECMGKIRNAYAKGHLTYIPQGAHQLLRKASLLV
GLQNNSFYSTQSKMFEEAMQLPSKPPGFNELALLVLSGELTDSEVVYKHCEDLWQGLNTW
FDELGIQYKVTSLPF
Download sequence
Identical sequences A0A0A2UUY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]