SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A2WSK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2WSK5
Domain Number 1 Region: 231-490
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-60
Family PFOR Pyr module 0.058
Further Details:      
 
Domain Number 2 Region: 4-251
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.02e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 507-605
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.34e-16
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2WSK5
Sequence length 617
Comment (tr|A0A0A2WSK5|A0A0A2WSK5_THEFI) 2-oxoacid:ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KGQ22803.1} KW=Complete proteome; Reference proteome OX=276 OS=Thermus filiformis. GN=THFILI_04165 OC=Thermus.
Sequence
MESFTWRVGGPQGSGVETAATLFARAVAKGGWWAASRREYHSNIMGRHSYLDVRLGRKPI
RGFYERVEMLVALDGETLARHLGEVKPGGVVLYDPKHLSLTLSKLPMLDHRLRDELAERL
GEADPGLSKVLEAYVAQGVQPLPYPYEEVADRIGEALGVPALQARRTLNTIAVAASLHFM
GYPKEPLLEALALQFRGQVLELNRKVVEAVYQEEVPQVAFRLTTNGYEPGRVYLTGAQAA
ALGKLAGGLRFQTYYPISPATDESVYLEAHTAFQGADVAVVQTEDEIAAVTMAVGAAMAG
ARAATATSGPGFSLMAEGLGFAGMAEVPLVVTLYQRGGPSTGLPTRTEQGDLFFAIRGGH
GEYPRLVLASGDVAEAFQDAQRALNWAWTYQLVVVHLLDKFLASTGEVLPREALPLLGVR
EGPKVAPREGRPEVYPRFEPGPDGLSPYLPLGTPGWFYWITSDEHDPEGHITEDPRIREA
QMEKRMAKLEAARRGIPQEELYALFREGRVMVLGWGSVKGALLEALEELPEVGFLHLRLL
WPFPEIRELLEGRTLVTVEHNYSGQLADLVRQETGLEVAHRVVKYNGRPITVDEAVEALK
AVLSGQAPGRLVLRGGV
Download sequence
Identical sequences A0A0A2WSK5
WP_038061306.1.15202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]