SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2YNP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2YNP8
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.4e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.66e-26
Family Ribosomal protein L11, C-terminal domain 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2YNP8
Sequence length 142
Comment (tr|A0A0A2YNP8|A0A0A2YNP8_9PAST) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome OX=750 OS=Gallibacterium anatis. GN=JP29_02960 OC=Pasteurellaceae; Gallibacterium.
Sequence
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESIEKGLPIPVVIT
VYADRSFTFITKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTRQQVREIAELKAADMTGA
TIETKMKSIEGTARSMGLVVED
Download sequence
Identical sequences A0A0A2YNP8 A0A0A3A201 A0A0A3A9I6 A0A1A7QFC8 U1I3U4
WP_018346337.1.12054 WP_018346337.1.25043 WP_018346337.1.29791 WP_018346337.1.35356 WP_018346337.1.37689 WP_018346337.1.5524 WP_018346337.1.56014 WP_018346337.1.56086 WP_018346337.1.63960 WP_018346337.1.66043 WP_018346337.1.68549 WP_018346337.1.95155 WP_018346337.1.95450 WP_018346337.1.97874 WP_018346337.1.97965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]