SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2YVV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2YVV1
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily MtlR-like 1.57e-49
Family MtlR-like 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2YVV1
Sequence length 166
Comment (tr|A0A0A2YVV1|A0A0A2YVV1_9PAST) Mannitol repressor protein {ECO:0000313|EMBL:KGQ41444.1} KW=Complete proteome OX=1396514 OS=Gallibacterium anatis IPDH697-78. GN=JP30_04830 OC=Pasteurellaceae; Gallibacterium.
Sequence
MIEEKLNEVTTARGLIIAAVTVFEEALDQLINKVFRKTDFVVESVIESLFEHSGPLFDFK
IRLKVLLGLGVISKDIFEDIEQFLKLKEIINNQTQELSFSDPLLLDFVQQLNCIKDSLFI
KDPPPKPTQDSLLEQVKIIRWEKMIRSYITLAIITIHEALLIESPL
Download sequence
Identical sequences A0A0A2XD47 A0A0A2XSJ7 A0A0A2YVV1 A0A0A3AK22
WP_039087503.1.24514 WP_039087503.1.26418 WP_039087503.1.26593 WP_039087503.1.37689 WP_039087503.1.45092 WP_039087503.1.56014 WP_039087503.1.66043 WP_039087503.1.68378 WP_039087503.1.68549 WP_039087503.1.82856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]