SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3WJS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3WJS3
Domain Number 1 Region: 12-113
Classification Level Classification E-value
Superfamily HisI-like 4.71e-43
Family HisI-like 0.00017
Further Details:      
 
Domain Number 2 Region: 117-205
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.61e-21
Family HisE-like (PRA-PH) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A3WJS3
Sequence length 206
Comment (tr|A0A0A3WJS3|A0A0A3WJS3_XANCH) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome OX=317013 OS=Xanthomonas campestris pv. phaseoli. GN=PK68_08225 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MGSNQVATGETLATLDWSKGDGLLPAIVQDADTLRVLMLGYMNAQALAVTQQRGEVTFFS
RSKQRLWTKGESSGNVLRVVSIETDCDADTLLVQARPHGPTCHLGRTSCFPSAPGQFLGS
LDALVAERERERPQGSYTTKLFEQGIRRIAQKVGEEGVETALAGVVQDDDALLGESADLL
YHLIVLLRARGLGLGDAVALLESRHR
Download sequence
Identical sequences A0A0A3WJS3
WP_039572508.1.14032 WP_039572508.1.25999 WP_039572508.1.31364 WP_039572508.1.34035 WP_039572508.1.43567 WP_039572508.1.49137 WP_039572508.1.52218 WP_039572508.1.56360 WP_039572508.1.72777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]