SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3XME6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3XME6
Domain Number 1 Region: 13-99
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 2.62e-31
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00042
Further Details:      
 
Domain Number 2 Region: 148-197
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000762
Family AraC type transcriptional activator 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A3XME6
Sequence length 198
Comment (tr|A0A0A3XME6|A0A0A3XME6_BRAJP) Transcriptional regulator {ECO:0000313|EMBL:KGT74346.1} KW=Complete proteome OX=375 OS=Bradyrhizobium japonicum. GN=MA20_40430 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MAIGSAHRQTLPPHLDWETCDRARLARARAFDGLFFSGVRSTRIYCRPVCPVRPARSENV
TFYATAAAAERAGFRPCLRCRPETAPGSPAWMGTATTVARGMRLINDGFLDRASMMDLAE
VLGVGPRHLLRLFMRHAGASPSEIAATRRVQEAKRLIDQTSMTLAEIAFAAGFGSVRRFN
DAFVATYKRPPSSFRRRH
Download sequence
Identical sequences A0A0A3XME6
WP_028160387.1.67973 WP_028160387.1.85912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]