SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3Y026 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3Y026
Domain Number 1 Region: 57-99
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000000000863
Family H-NS histone-like proteins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A3Y026
Sequence length 110
Comment (tr|A0A0A3Y026|A0A0A3Y026_BRAJP) Histidinol phosphate phosphatase {ECO:0000313|EMBL:KGT78771.1} KW=Complete proteome OX=375 OS=Bradyrhizobium japonicum. GN=MA20_15465 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MRKPDLDAMAFDDLWLLHEEVTRILSEKITTEKLELEKRLAQLAPAGRSEPRARRPYRKA
PPKYFNPVEPSETWSGRGRQPRWLVAALQSGHKIEEFQIGAGDKEAEGSA
Download sequence
Identical sequences A0A0A3Y026
WP_028159657.1.67973 WP_028159657.1.85912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]