SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3YKZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A3YKZ8
Domain Number - Region: 138-185
Classification Level Classification E-value
Superfamily Barstar-related 0.0759
Family Barstar-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A3YKZ8
Sequence length 248
Comment (tr|A0A0A3YKZ8|A0A0A3YKZ8_9ENTR) Siderophore-iron reductase, Fe-S cluster protein {ECO:0000313|EMBL:KGT86179.1} KW=Complete proteome OX=69218 OS=Enterobacter cancerogenus. GN=NH00_25940 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MLTPEEQAFLQKNFRLRPLAAADARSMPAEYVLNAKHCDAFLRLVMPLTGAPDVAIAASL
FAKRLAFLATGNVLYAMSVFDSGLTFSLSRSRLEYAHDNGLWTSSLPADTLVTCYLPGER
DAWREEVVSALFRGFLSPLWQSLAGVSGLPIQILWENTAMRVFSLYQGRMDRLDETQNER
RDADFNWLIGQASPSLFGLSWNPLQRFRRPLQLNAAGKPVRFRRTCCFYYKATDPVEYCL
NCPLCRPK
Download sequence
Identical sequences A0A0A3YKZ8
WP_034831095.1.37972 WP_034831095.1.76962 2030361065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]