SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A4GGD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A4GGD1
Domain Number 1 Region: 192-376
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-62
Family Methylesterase CheB, C-terminal domain 0.00000817
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 5.83e-27
Family CheY-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A4GGD1
Sequence length 378
Comment (tr|A0A0A4GGD1|A0A0A4GGD1_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1348058 OS=Pseudomonas mediterranea CFBP 5447. GN=N005_13420 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVVKVLVVDDSGFFRRRVSEILSADTTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPDKVRQ
LLCEKVHSISRSNRRVSAYTPPAPAPVAAPSPASSSGSFNPPPVRSAPAPAPARPAPASA
SASASSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAE
RLDKLCNISVKEAEDGDILRPGLALLAPGGKQMMVDGRGAVKILPGDERLNYKPCVDITF
GSAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIVKADLA
DAVYGLDDIGKNLVEACL
Download sequence
Identical sequences A0A0A4GGD1
WP_047701633.1.23779 WP_047701633.1.42967 WP_047701633.1.44014 WP_047701633.1.68927 WP_047701633.1.76864 WP_047701633.1.95574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]