SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5GGF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5GGF3
Domain Number 1 Region: 45-113
Classification Level Classification E-value
Superfamily Barstar-related 0.000000000000128
Family Barstar-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A5GGF3
Sequence length 152
Comment (tr|A0A0A5GGF3|A0A0A5GGF3_9BACI) Barnase inhibitor {ECO:0000313|EMBL:KGX91054.1} KW=Complete proteome; Reference proteome OX=1385510 OS=Pontibacillus halophilus JSM 076056 = DSM 19796. GN=N781_04900 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MDTWKQLMLTGSVKKYRENQVLHRYQEELMNEGFTVYTFDCRLWDECNYHRDLATTLHFP
DYYGNNLHALHDCLTELEAEGGGILLVFTHYDRFAEQFPPVAHAILDTIQAAAWELLLEQ
VKLVAFVQMSEEDLPFEQLGVRHAEWNDAEFL
Download sequence
Identical sequences A0A0A5GGF3
WP_051239948.1.27542 WP_051239948.1.52306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]