SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5JK11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5JK11
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 5.5e-67
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A5JK11
Sequence length 184
Comment (tr|A0A0A5JK11|A0A0A5JK11_9VIBR) N-acetyl-anhydromuranmyl-L-alanine amidase {ECO:0000313|EMBL:KGY08288.1} KW=Complete proteome; Reference proteome OX=379097 OS=Vibrio sinaloensis. GN=NM06_12530 OC=Vibrionaceae; Vibrio; Vibrio oreintalis group.
Sequence
MIDDRGWYRPARHVPSPFFDRRSDETDISLLVVHNISLPPGQFGGPYIEQFFTGKLDPNE
HPFFKVIHNMDVSAHCLIRRDGEIIQFVPFNTRAWHAGVSSFAGREKCNDYSIGIELEGC
DYVAYTDAQYQSLTELTQQLQLRYPQITSSRITGHQYIAPLRKSDPGLVFDWRRFHDALK
RCES
Download sequence
Identical sequences A0A0A5JK11
WP_038191320.1.37862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]