SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6D5C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6D5C7
Domain Number 1 Region: 73-266
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.86e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 5-72
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 4.18e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A6D5C7
Sequence length 275
Comment (tr|A0A0A6D5C7|A0A0A6D5C7_9PSED) Chemotaxis protein {ECO:0000313|EMBL:KHA69932.1} KW=Complete proteome OX=587753 OS=Pseudomonas chlororaphis. GN=NZ35_28310 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSTGNLDFEQFRVFLEKACGILLGENKQYLVSSRLNKLMEQQGIKSLGELVQRIQTQPRS
GLREQVVDAMTTNETLWFRDTYPFEVLKNKVLPEAIKASPNQRLRIWSAACSSGQEPYSL
SMSIDEFERSNLGQLKMGVQIVATDLSGLMLTNCKTGEYDSLAIGRGLSPERLQRYFDPK
GPGRWVIKAPIKNRVEFRSFNLLDSYAALGKFDIVFCRNVLIYFSAEVKKDILLRIHSTL
KPGGYLFLGASEALNGLPDHYQMVQCSPGIIYQAK
Download sequence
Identical sequences A0A0A6D5C7 A0A0P6SDD3 A0A1V3T4C8 J2MK51 J2XSU9 J2YLM6
WP_007917583.1.101277 WP_007917583.1.31844 WP_007917583.1.33932 WP_007917583.1.58129 WP_007917583.1.82411 WP_007917583.1.99178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]