SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6DAL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6DAL1
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily YcfC-like 1.23e-72
Family YcfC-like 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A6DAL1
Sequence length 207
Comment (tr|A0A0A6DAL1|A0A0A6DAL1_9PSED) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome OX=587753 OS=Pseudomonas chlororaphis. GN=NZ35_12745 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSPTQEQLTALGGVFLAAVLVDRIAKTGQTSEAGLTCMLGSLLVRDPKDTLDVYGGDDLN
LREGYRALIGALERDPSTLQREPLRYALSMLGLERQLAKRNDMLDTIGKRLPQIQSQVEH
FGPAHENVVAACGALYQDTLSTLRQRIQVHGDMRNLQQPSNASKIRALLLAGIRSARLWR
QLGGHRWQLVISRRKLLKELYPLMRSE
Download sequence
Identical sequences A0A0A6DAL1
WP_038362633.1.31844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]