SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A6DGN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6DGN2
Domain Number 1 Region: 151-334
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-59
Family Methylesterase CheB, C-terminal domain 0.0000416
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily CheY-like 2.56e-22
Family CheY-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A6DGN2
Sequence length 336
Comment (tr|A0A0A6DGN2|A0A0A6DGN2_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=587753 OS=Pseudomonas chlororaphis. GN=NZ35_01830 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKIAIVNDMPMAVEALRRALAFEPAHQVVWVARNGAEAVQLCAENTPDLILMDLIMPVMD
GVEATRRIMAESPCAIVIVTVDRQQNVHRVFEAMGHGALDVVDTPALGAGNAQEAAAPLL
RKILNIGWLIGDKPQRSRPAPTPQRSSASCKRLVAIGSSAGGPAALEVLLKGLPRDFSAA
IVLVQHVDQVFAAGMAEWLASASGLDVRLAREGEPPQAGAVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVASYWNGEAVGVLLTGMGRDGAQGLKLMRQQGYLTIAQDQQ
SSAVYGMPKAAAAIDAAVEIRALEKIAPRLLEVFPK
Download sequence
Identical sequences A0A0A6DGN2
WP_038357805.1.31844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]