SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6MYC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6MYC6
Domain Number 1 Region: 91-279
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.91e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 19-90
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000314
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A6MYC6
Sequence length 282
Comment (tr|A0A0A6MYC6|A0A0A6MYC6_9THEM) Chemotactic methyltransferase {ECO:0000313|EMBL:KHC90523.1} KW=Complete proteome OX=1231241 OS=Thermotoga sp. Mc24. GN=Mc24_09184 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MQEERSEKKIGPFKFQSNFEWKEFPQEEFEWFVKEVEKRFGLNLSSYKPQRVKRRTELLL
RKYNVDYREYINMLTKDKKYLDEFMDKMTINVTEFFRNPEKWWELRDEIIPLIAKNSLRM
KFWSAGCSSGEEPYSLAILVHELNLSYKTRILATDIDIGVLRRAQEGIYEERAFVSTPKE
YLEKYFEKLPDGRYRIKDSVKKIVEFKMHDLLRDPFEKNFDLILCRNVVIYFEPEAKNEL
YRKFAESMKLGGFFFVGNTERIFNYKELGFEIYKPFIYRKVK
Download sequence
Identical sequences A0A0A6MYC6
WP_038054724.1.1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]