SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6PPW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6PPW9
Domain Number 1 Region: 5-281
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.49e-96
Family Methylenetetrahydrofolate reductase 0.000000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A6PPW9
Sequence length 282
Comment (tr|A0A0A6PPW9|A0A0A6PPW9_9GAMM) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=1003181 OS=Candidatus Thiomargarita nelsonii. GN=OT06_04670 OC=Thiotrichaceae; Thiomargarita.
Sequence
MTSQQQALTISCEFFPPRTEKGMLKLRETREQLQDLQPAFFSVTFGAGGGTREKTFETVL
EIQKQSNFEAAPHLSCIGSTHENILKLLQDYQAHGIRRIVALRGDKPSGWAGTFGDISYA
NELVEFIRAETGSYFQIEVAAYPEFHPQASSAKDDLDYFKQKVEAGANSAITQYFYNADA
YFRFIDSCTERGIDIPIVPGIMPITNYEQLTRFSDGCGAEIPRWLRWRLKDLADDKEAVQ
AFGVDVMTSLCERLLAGGAPGLHFYTLNQASFTLEIAKRLGL
Download sequence
Identical sequences A0A0A6PPW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]