SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A6PSK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6PSK0
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000392
Family NfeD domain-like 0.0037
Further Details:      
 
Weak hits

Sequence:  A0A0A6PSK0
Domain Number - Region: 21-78
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00327
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A6PSK0
Sequence length 143
Comment (tr|A0A0A6PSK0|A0A0A6PSK0_CLOBU) Nodulation efficiency protein D {ECO:0000313|EMBL:KHD13379.1} KW=Complete proteome OX=1492 OS=Clostridium butyricum. GN=OA81_08960 OC=Clostridium.
Sequence
MGAIILWILIAIGSFVIDILSSSFCFVLLSAGSIAAAICASLGMSIAMQVIVFAVINIIS
MSVGYPWLKKKFKKGFTKTLRMEETYIGKVIKAEKEISNKAQIKVNGEYWTAVNTGVDIK
QGEEFIITGIEGIKLLIKKVEEE
Download sequence
Identical sequences A0A0A6PSK0 A0A0F4VP97 A0A0F4WPL6 A0A0F4WVT2 A0A1F1KW14 R0ASZ4
WP_002579487.1.1134 WP_002579487.1.34338 WP_002579487.1.36140 WP_002579487.1.57752 WP_002579487.1.65800 WP_002579487.1.72530 WP_002579487.1.80406 WP_002579487.1.80740 WP_002579487.1.86677 WP_002579487.1.91059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]