SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6YFP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6YFP5
Domain Number 1 Region: 22-191
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.32e-56
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000039
Further Details:      
 
Domain Number 2 Region: 196-270
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-17
Family Peptidoglycan binding domain, PGBD 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A6YFP5
Sequence length 274
Comment (tr|A0A0A6YFP5|A0A0A6YFP5_9GAMM) N-acetylmuramoyl-L-alanine amidase amid {ECO:0000313|EMBL:KHN62251.1} KW=Complete proteome OX=66269 OS=Pantoea stewartii. GN=OI73_15595 OC=Erwiniaceae; Pantoea.
Sequence
MKRLLCCLMALLLAGCHSGIESRSGYWVDLRHPAQGARPRVKVVVIHYTAEDFSSSLATL
TDRDVSVHYLIPRQPPQRNGKGIIWQLVPEQDLAWHAGASFWRGATRINDTSVGIELVNN
GYRRTPAGVTWQPFPPAQIRTLAALVRDITQRYGIAPENIVGHSDIAPQRKQDPGPLFPW
QQLAAEGIGAWPDSQRVAFYLAGRDRYAAVPAATLLECLQRYGYQVTEGMSADEQQKLIA
AFQMHFRSANIQGFADAETLAIAQALLEKYGTAQ
Download sequence
Identical sequences A0A0A6YFP5
WP_039341352.1.15836 WP_039341352.1.25826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]