SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6YTI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A6YTI1
Domain Number 1 Region: 164-236
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 6.41e-20
Family C-terminal domain of RNA polymerase alpha subunit 0.00063
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.19e-16
Family Insert subdomain of RNA polymerase alpha subunit 0.0013
Further Details:      
 
Domain Number 3 Region: 78-139
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 0.00000000000000267
Family RNA polymerase alpha subunit dimerisation domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A6YTI1
Sequence length 239
Comment (tr|A0A0A6YTI1|A0A0A6YTI1_9FLAO) DNA-directed RNA polymerase, alpha subunit {ECO:0000313|EMBL:KHE70735.1} KW=Complete proteome; Reference proteome OX=706436 OS=Capnocytophaga sp. oral taxon 329 str. F0087. GN=HMPREF9074_07439 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MEDVEEETATISVSGKKQLTAGDFQKTLSGFQILNPDLVICNMETTASFSMTITIEKGRG
YVSAEENAKPNAAIGVIATDSIFTPVKNVKYSIENYRVEQKTDYEKLVFEIKTDGSIHPK
FALTEAAKTLIHHFMLFSDERITLEADEVAQTDAYDEESLHMRQLLKTKLIDMDLSVRAL
NCLKAAEVETLGDLVSFNKADLMKFRNFGKKSLIELDELVANKGLVFGMDISKYKLDKD
Download sequence
Identical sequences A0A0A6YTI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]