SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7C4H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7C4H4
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.62e-86
Family MHC antigen-recognition domain 0.00000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A7C4H4
Sequence length 181
Comment (tr|A0A0A7C4H4|A0A0A7C4H4_HUMAN) MHC class I antigen {ECO:0000313|EMBL:AHY61541.1} OX=9606 OS=Homo sapiens (Human). GN=HLA-A OC=Catarrhini; Hominidae; Homo.
Sequence
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWD
QETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGK
DYIALNEDLRSWTAADMAAQITKRKWEAAHVAEQWRAYLEGRCVEWLRRYLENGKETLQR
T
Download sequence
Identical sequences A0A0A7C4H4 A0A0G2R0P1 A0A0G2R0W5 A0A0G2R1F3 A0A0X7YRA5 I6QQS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]