SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7C5E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7C5E5
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.25e-83
Family MHC antigen-recognition domain 0.0000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7C5E5
Sequence length 181
Comment (tr|A0A0A7C5E5|A0A0A7C5E5_HUMAN) MHC class I antigen {ECO:0000313|EMBL:AHY61901.1} OX=9606 OS=Homo sapiens (Human). GN=HLA-C OC=Catarrhini; Hominidae; Homo.
Sequence
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWD
RETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGK
DYIALNEDLRSWTAADKAAQITQRKWEAAREAEQLRAYLEGTCVESLRRYLENGKKTLQR
A
Download sequence
Identical sequences A0A0A7C5E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]