SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7EE72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7EE72
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.53e-32
Family Frataxin-like 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7EE72
Sequence length 106
Comment (tr|A0A0A7EE72|A0A0A7EE72_9GAMM) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome; Reference proteome OX=1348114 OS=Pseudoalteromonas piratica. GN=OM33_03465 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MTDQEYHQLIEDLFINLEEQVDACEVDLDYESASGILEIIFPDGSKIILNKQAPLHQLWV
ATKFNGHHFERHGDKWIDNRSGAEFWQFMNDAASKQAGTNIVWEAE
Download sequence
Identical sequences A0A0A7EE72
WP_038638811.1.57028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]