SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7K6F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7K6F6
Domain Number 1 Region: 210-337
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 3.92e-43
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0000588
Further Details:      
 
Domain Number 2 Region: 8-190
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.76e-35
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7K6F6
Sequence length 337
Comment (tr|A0A0A7K6F6|A0A0A7K6F6_9FLAO) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome OX=1348584 OS=Cellulophaga baltica 18. GN=M666_08875 OC=Flavobacteriaceae; Cellulophaga.
Sequence
MKIKNNVSLKPYNTFGIDAKARFFYEITTLTALESVLKLEEYPNKFVISGGSNMLLTKDI
DALVLHLNLKGIKIVSETDHDVIINVMAGENWHELVLWTLDQNYGGLENMSLIPGNTGTS
PIQNIGAYGVELKDTFESCEAMEIATQKLKIFNKETCNFGYRESFFKNEGKGKYIITSVN
LKLSKKDHVLNTSYGSIDQELQHMGITTPTIKDISNAVIAIRKSKLPDPAELGNSGSFFK
NPIINKIDFLHFIEKHPEAPFYKLSEENYKIPAGWLIEQSGFKGKRYGDAGVHKNQALVL
VNYGTATGKEIVDLAHKIIDTVYAKFNIRILPEVNIV
Download sequence
Identical sequences A0A0A7K6F6
WP_029446994.1.24425 WP_029446994.1.70598 WP_029446994.1.82627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]