SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7RGZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7RGZ2
Domain Number 1 Region: 155-337
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.11e-61
Family Methylesterase CheB, C-terminal domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 2.28e-31
Family CheY-related 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A7RGZ2
Sequence length 339
Comment (tr|A0A0A7RGZ2|A0A0A7RGZ2_9LACO) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1133569 OS=Lactobacillus vini DSM 20605. GN=FD21_GL000998 OC=Lactobacillus.
Sequence
MNVLIVDDSAFMRKVITDFVKKISCVKNVDLAHDGQEAFEKIKVNNNIDLVLMDVEMPVM
DGLTALKKIKNFQRNLPIVMLSALNNRQVTIEALEAGAADFIEKPVNLLNISQDWVADFK
AKILMVGDKKNQLQSMAQDSTDKAPTSINSRPMPRMINALVIGASTGGPKTLLEIIRNLP
PVLRIPIFIVQHMPKGFTASFAQRMNSETACTVVEAKDGMPIQRQVYLCPGDYHMTLETG
KIKLNQLPKLHGTRPAVDYLFMSAAEVYRANLVAVLLTGMGSDGAKGMAEIQRLGGYNIV
ENEESCVIFGMPGSAIELGVVNEVLSLTTIKKRINQITR
Download sequence
Identical sequences A0A0A7RGZ2
WP_010580531.1.37165 WP_010580531.1.49249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]